PDB entry 1q13

View 1q13 on RCSB PDB site
Description: Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with NADP and testosterone
Class: oxidoreductase
Keywords: 20alpha-HSD, hydroxysteroid dehydrogenase, aldo-keto reductase, TIM-barrel, AKR, testosterone, ternary complex, OXIDOREDUCTASE
Deposited on 2003-07-18, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin-E2 9-reductase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q13a_
  • Chain 'B':
    Compound: Prostaglandin-E2 9-reductase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q13b_
  • Heterogens: SO4, NAP, TES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q13A (A:)
    mdpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfykneke
    vglairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpt
    alkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpl
    igalakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidsln
    rnfryvtadfaighpnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q13A (A:)
    dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
    glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
    lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
    lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
    galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
    nfryvtadfaighpnypfsdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q13B (B:)
    mdpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfykneke
    vglairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpt
    alkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpl
    igalakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidsln
    rnfryvtadfaighpnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q13B (B:)
    dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
    glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
    lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
    lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepsapvlledpligalak
    khqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnrnfryv
    tadfaighpnypfsdey