![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Pseudoazurin [49522] (4 species) |
![]() | Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (13 PDB entries) Uniprot P04377 |
![]() | Domain d1py0a_: 1py0 A: [111645] complexed with so4, y1, yma, zn |
PDB Entry: 1py0 (more details), 2 Å
SCOPe Domain Sequences for d1py0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1py0a_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} asenievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipcgackfks kinenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekv ia
Timeline for d1py0a_: