Lineage for d1py0a1 (1py0 A:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770950Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (14 PDB entries)
    Uniprot P04377
  8. 2770956Domain d1py0a1: 1py0 A:1-120 [111645]
    Other proteins in same PDB: d1py0a2
    complexed with so4, y1, yma, zn

Details for d1py0a1

PDB Entry: 1py0 (more details), 2 Å

PDB Description: crystal structure of e51c/e54c psaz from a.faecalis with clanp probe
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1py0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1py0a1 b.6.1.1 (A:1-120) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipcgackfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOPe Domain Coordinates for d1py0a1:

Click to download the PDB-style file with coordinates for d1py0a1.
(The format of our PDB-style files is described here.)

Timeline for d1py0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1py0a2