SCOPe 2.08: Domain d1py0a1: 1py0 A:1-120

Lineage for d1py0a1 (1py0 A:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Pseudoazurin [49522] (4 species)

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (14 PDB entries)
   Uniprot P04377

8. Domain d1py0a1: 1py0 A:1-120 [111645]
   Other proteins in same PDB: d1py0a2
   complexed with so4, y1, yma, zn

Details for d1py0a1

PDB Entry: 1py0, 2 Å

PDB Description: crystal structure of e51c/e54c psaz from a.faecalis with clanp probe

PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1py0a1:

Sequence; same for both SEQRES and ATOM records:

>d1py0a1 b.6.1.1 (A:1-120) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipcgackfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

Timeline for d1py0a1:

• d1py0a1 first appeared in SCOP 1.71, called d1py0a_
  
• d1py0a1 appears in SCOPe 2.07