Lineage for d1xe1a_ (1xe1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793116Protein Hypothetical protein PF0907 [110227] (1 species)
    stand-alone protein related to this domain
  7. 2793117Species Pyrococcus furiosus [TaxId:2261] [110228] (2 PDB entries)
    Uniprot Q8U2D2 18-108
  8. 2793118Domain d1xe1a_: 1xe1 A: [109571]
    Structural genomics target
    complexed with so4

Details for d1xe1a_

PDB Entry: 1xe1 (more details), 2 Å

PDB Description: hypothetical protein from pyrococcus furiosus pfu-880080-001
PDB Compounds: (A:) hypothetical protein PF0907

SCOPe Domain Sequences for d1xe1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]}
ieilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivriernrekv
efaiagdrigisiegkigkvkkgdvleiyqt

SCOPe Domain Coordinates for d1xe1a_:

Click to download the PDB-style file with coordinates for d1xe1a_.
(The format of our PDB-style files is described here.)

Timeline for d1xe1a_: