Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Hypothetical protein PF0907 [110227] (1 species) stand-alone protein related to this domain |
Species Pyrococcus furiosus [TaxId:2261] [110228] (2 PDB entries) Uniprot Q8U2D2 18-108 |
Domain d1xe1a_: 1xe1 A: [109571] Structural genomics target complexed with so4 |
PDB Entry: 1xe1 (more details), 2 Å
SCOPe Domain Sequences for d1xe1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} ieilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivriernrekv efaiagdrigisiegkigkvkkgdvleiyqt
Timeline for d1xe1a_: