Lineage for d1xe1a_ (1xe1 A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.3: Translation proteins [50447] (2 families) 
Family b.43.3.1: Elongation factors [50448] (8 proteins) 
Protein Hypothetical protein PF0907 [110227] (1 species)
stand-alone protein related to this domainSpecies Pyrococcus furiosus [TaxId:186497] [110228] (1 PDB entry) 
Domain d1xe1a_: 1xe1 A: [109571]
Structural genomics target
Details for d1xe1a_
PDB Entry: 1xe1 (more details), 2 Å
PDB Description: hypothetical protein from pyrococcus furiosus pfu-880080-001
SCOP Domain Sequences for d1xe1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus}
ieilskkpagkvvveevvnimgkdviigtvesgmigvgfkvkgpsgiggivriernrekv
efaiagdrigisiegkigkvkkgdvleiyqt
SCOP Domain Coordinates for d1xe1a_:
Click to download the PDB-style file with coordinates for d1xe1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xe1a_:
- d1xe1a_ is new in SCOP 1.69
- d1xe1a_ appears in SCOP 1.71
- d1xe1a_ appears in the current release, SCOPe 2.08
View in 3D