![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
![]() | Family d.278.1.1: H-NOX domain [111127] (2 proteins) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains automatically mapped to Pfam PF07700 |
![]() | Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
![]() | Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries) Uniprot Q8RBX6 1-191 |
![]() | Domain d1xbna1: 1xbn A:1-191 [109541] Other proteins in same PDB: d1xbna2 complexed with hem, oxy |
PDB Entry: 1xbn (more details), 2.5 Å
SCOPe Domain Sequences for d1xbna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbna1 d.278.1.1 (A:1-191) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvfeykknvwg
Timeline for d1xbna1: