PDB entry 1xbn

View 1xbn on RCSB PDB site
Description: Crystal structure of a bacterial nitric oxide sensor: an ortholog of mammalian soluble guanylate cyclase heme domain
Class: signaling protein
Keywords: soluble guanylyl cyclase, nitric oxide, heme protein, cgmp, signaling protein
Deposited on 2004-08-30, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.265
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermoanaerobacter tengcongensis MB4 [TaxId:273068]
    Gene: Tar4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RBX6 (0-190)
      • cloning artifact (191-194)
    Domains in SCOPe 2.08: d1xbna1, d1xbna2
  • Heterogens: OXY, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xbnA (A:)
    mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykknvwglvpr