Lineage for d1x72a_ (1x72 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510635Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 510636Superfamily d.126.1: Pentein [55909] (6 families) (S)
  5. 510684Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase (Pfam 04371) [111155] (2 proteins)
    functionally related to the amidinotransferase, similar active site
  6. 510689Protein Putative peptidyl-arginine deiminase [111158] (1 species)
  7. 510690Species Helicobacter pylori J99 [TaxId:85963] [111159] (1 PDB entry)
  8. 510691Domain d1x72a_: 1x72 A: [109495]
    Structural genomics target

Details for d1x72a_

PDB Entry: 1x72 (more details), 2.5 Å

PDB Description: Crystal structure of a putative peptidyl-arginine deiminase.

SCOP Domain Sequences for d1x72a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x72a_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Helicobacter pylori J99}
mslkrmlaefekiqailmafphefsdwaycieearesflhiiqtiakhakvlvcvhtndt
igyemlknlpgveiaridtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv
nfklkhlgflkhplktmpyileggsiesdgagsiltntqclleknrnphlnqngietmlk
kelgakqvlwysygylkgddtdshtdtlarflnkdtivysacedendehytalkkmqeel
ktfkkldgtpyklipleipkaiynenqqrlpatyvnfllcnnalivptyndpndtlilet
lrqhtplevigvdcntlikqhgslhcvtmqlyeg

SCOP Domain Coordinates for d1x72a_:

Click to download the PDB-style file with coordinates for d1x72a_.
(The format of our PDB-style files is described here.)

Timeline for d1x72a_: