![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (6 families) ![]() |
![]() | Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins) Pfam 04371; functionally related to the amidinotransferase, similar active site |
![]() | Protein Putative peptidyl-arginine deiminase [111158] (2 species) |
![]() | Species Helicobacter pylori J99 [TaxId:85963] [111159] (1 PDB entry) |
![]() | Domain d1x72a_: 1x72 A: [109495] Structural genomics target mutant |
PDB Entry: 1x72 (more details), 2.5 Å
SCOP Domain Sequences for d1x72a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x72a_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Helicobacter pylori J99} mslkrmlaefekiqailmafphefsdwaycieearesflhiiqtiakhakvlvcvhtndt igyemlknlpgveiaridtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv nfklkhlgflkhplktmpyileggsiesdgagsiltntqclleknrnphlnqngietmlk kelgakqvlwysygylkgddtdshtdtlarflnkdtivysacedendehytalkkmqeel ktfkkldgtpyklipleipkaiynenqqrlpatyvnfllcnnalivptyndpndtlilet lrqhtplevigvdcntlikqhgslhcvtmqlyeg
Timeline for d1x72a_: