SCOP 1.73: Domain d1x72a_: 1x72 A:

Lineage for d1x72a_ (1x72 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein Putative peptidyl-arginine deiminase [111158] (3 species)

7. Species Helicobacter pylori J99 [TaxId:85963] [111159] (1 PDB entry)

8. Domain d1x72a_: 1x72 A: [109495]
   Structural genomics target
   mutant

Details for d1x72a_

PDB Entry: 1x72, 2.5 Å

PDB Description: Crystal structure of a putative peptidyl-arginine deiminase.

PDB Compounds: (A:) putative peptidyl-arginine deiminase

SCOP Domain Sequences for d1x72a_:

Sequence; same for both SEQRES and ATOM records:

>d1x72a_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Helicobacter pylori J99 [TaxId: 85963]}
mslkrmlaefekiqailmafphefsdwaycieearesflhiiqtiakhakvlvcvhtndt
igyemlknlpgveiaridtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv
nfklkhlgflkhplktmpyileggsiesdgagsiltntqclleknrnphlnqngietmlk
kelgakqvlwysygylkgddtdshtdtlarflnkdtivysacedendehytalkkmqeel
ktfkkldgtpyklipleipkaiynenqqrlpatyvnfllcnnalivptyndpndtlilet
lrqhtplevigvdcntlikqhgslhcvtmqlyeg

Timeline for d1x72a_:

• d1x72a_ first appeared in SCOP 1.69
  
• d1x72a_ appears in SCOP 1.71
  
• d1x72a_ does not appear in SCOP 1.75