Lineage for d1wplh_ (1wpl H:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608476Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 608477Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 608478Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 608479Protein GTP cyclohydrolase I [55622] (3 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 608592Species Rat (Rattus norvegicus) [TaxId:10116] [69790] (3 PDB entries)
  8. 608610Domain d1wplh_: 1wpl H: [109479]
    Other proteins in same PDB: d1wplk_, d1wpll_, d1wplm_, d1wpln_, d1wplo_, d1wplp_, d1wplq_, d1wplr_, d1wpls_, d1wplt_

Details for d1wplh_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

SCOP Domain Sequences for d1wplh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wplh_ d.96.1.1 (H:) GTP cyclohydrolase I {Rat (Rattus norvegicus)}
rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
dpktreefltlirs

SCOP Domain Coordinates for d1wplh_:

Click to download the PDB-style file with coordinates for d1wplh_.
(The format of our PDB-style files is described here.)

Timeline for d1wplh_: