SCOP 1.71: Domain d1wplt_: 1wpl T:

Lineage for d1wplt_ (1wpl T:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)

6. Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)

8. Domain d1wplt_: 1wpl T: [109491]
   Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_
   complexed with 3po, hbi, na, zn

Details for d1wplt_

PDB Entry: 1wpl, 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

SCOP Domain Sequences for d1wplt_:

Sequence; same for both SEQRES and ATOM records:

>d1wplt_ d.205.1.1 (T:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

Timeline for d1wplt_:

• d1wplt_ first appeared in SCOP 1.69
  
• d1wplt_ appears in SCOP 1.73
  
• d1wplt_ appears in the current release, SCOPe 2.08