Lineage for d1woqb1 (1woq B:11-139)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605919Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 1605924Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species)
  7. 1605925Species Arthrobacter sp. KM [TaxId:184230] [110638] (1 PDB entry)
    Uniprot Q7WT42 11-263 # Fragment
  8. 1605928Domain d1woqb1: 1woq B:11-139 [109464]
    complexed with bgc, po4

Details for d1woqb1

PDB Entry: 1woq (more details), 1.8 Å

PDB Description: crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution
PDB Compounds: (B:) Inorganic polyphosphate/ATP-glucomannokinase

SCOPe Domain Sequences for d1woqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woqb1 c.55.1.10 (B:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}
napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
earygagag

SCOPe Domain Coordinates for d1woqb1:

Click to download the PDB-style file with coordinates for d1woqb1.
(The format of our PDB-style files is described here.)

Timeline for d1woqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1woqb2