SCOP 1.69: Domain d1woqb1: 1woq B:11-139

Lineage for d1woqb1 (1woq B:11-139)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK (Pfam 00480) [110636] (1 protein)

6. Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species)

7. Species Arthrobacter sp. strain KM [110638] (1 PDB entry)

8. Domain d1woqb1: 1woq B:11-139 [109464]

Details for d1woqb1

PDB Entry: 1woq, 1.8 Å

PDB Description: crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution

SCOP Domain Sequences for d1woqb1:

Sequence; same for both SEQRES and ATOM records:

>d1woqb1 c.55.1.10 (B:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. strain KM}
napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
earygagag

Timeline for d1woqb1:

• d1woqb1 is new in SCOP 1.69
  
• d1woqb1 appears in SCOP 1.71
  
• d1woqb1 appears in the current release, SCOPe 2.08