Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) duplication contains two domains of this fold |
Family c.55.1.10: ROK (Pfam 00480) [110636] (1 protein) |
Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species) |
Species Arthrobacter sp. strain KM [110638] (1 PDB entry) |
Domain d1woqb1: 1woq B:11-139 [109464] |
PDB Entry: 1woq (more details), 1.8 Å
SCOP Domain Sequences for d1woqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woqb1 c.55.1.10 (B:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. strain KM} napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla earygagag
Timeline for d1woqb1: