Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Lectin CEL-I [111262] (1 species) |
Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries) Uniprot Q7M462 |
Domain d1wmya_: 1wmy A: [109420] complexed with ca, mpd |
PDB Entry: 1wmy (more details), 2 Å
SCOPe Domain Sequences for d1wmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmya_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg awndnsaaaqakymckltfe
Timeline for d1wmya_: