Lineage for d1wmya_ (1wmy A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514405Protein Lectin CEL-I [111262] (1 species)
  7. 514406Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
  8. 514411Domain d1wmya_: 1wmy A: [109420]

Details for d1wmya_

PDB Entry: 1wmy (more details), 2 Å

PDB Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata

SCOP Domain Sequences for d1wmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmya_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOP Domain Coordinates for d1wmya_:

Click to download the PDB-style file with coordinates for d1wmya_.
(The format of our PDB-style files is described here.)

Timeline for d1wmya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wmyb_