Lineage for d1wmua_ (1wmu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976759Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1976760Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (3 PDB entries)
    Uniprot P83134
  8. 1976761Domain d1wmua_: 1wmu A: [109416]
    Other proteins in same PDB: d1wmub_
    complexed with hem

Details for d1wmua_

PDB Entry: 1wmu (more details), 1.65 Å

PDB Description: Crystal Structure of Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea, at 1.65 A resolution
PDB Compounds: (A:) Hemoglobin D alpha chain

SCOPe Domain Sequences for d1wmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
vqvaydkflaavsavlaekyr

SCOPe Domain Coordinates for d1wmua_:

Click to download the PDB-style file with coordinates for d1wmua_.
(The format of our PDB-style files is described here.)

Timeline for d1wmua_: