SCOPe 2.01: Domain d1wkqa_: 1wkq A:

Lineage for d1wkqa_ (1wkq A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Guanine deaminase GuaD [110765] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
   Uniprot O34598

8. Domain d1wkqa_: 1wkq A: [109393]
   complexed with imd, zn

Details for d1wkqa_

PDB Entry: 1wkq, 1.17 Å

PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily

PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d1wkqa_:

Sequence; same for both SEQRES and ATOM records:

>d1wkqa_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]}
hamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevta
irkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiy
keidkpaeertipfyqvtltehlspfqawrnfankkey

Timeline for d1wkqa_:

• d1wkqa_ first appeared in SCOP 1.69
  
• d1wkqa_ appears in SCOP 1.75
  
• d1wkqa_ appears in SCOPe 2.02
  
• d1wkqa_ appears in the current release, SCOPe 2.08, called d1wkqa1