SCOPe 2.08: Domain d1wkqa1: 1wkq A:1-156

Lineage for d1wkqa1 (1wkq A:1-156)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Guanine deaminase GuaD [110765] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
   Uniprot O34598

8. Domain d1wkqa1: 1wkq A:1-156 [109393]
   Other proteins in same PDB: d1wkqa2
   complexed with imd, zn

Details for d1wkqa1

PDB Entry: 1wkq, 1.17 Å

PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily

PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d1wkqa1:

Sequence; same for both SEQRES and ATOM records:

>d1wkqa1 c.97.1.2 (A:1-156) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]}
mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
idkpaeertipfyqvtltehlspfqawrnfankkey

Timeline for d1wkqa1:

• d1wkqa1 first appeared in SCOP 1.69, called d1wkqa_
  
• d1wkqa1 appears in SCOPe 2.07