SCOPe 2.07: Domain d1we3h2: 1we3 H:190-373

Lineage for d1we3h2 (1we3 H:190-373)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries)
   Uniprot P61491

8. Domain d1we3h2: 1we3 H:190-373 [109310]
   Other proteins in same PDB: d1we3a1, d1we3a3, d1we3b1, d1we3b3, d1we3c1, d1we3c3, d1we3d1, d1we3d3, d1we3e1, d1we3e3, d1we3f1, d1we3f3, d1we3g1, d1we3g3, d1we3h1, d1we3h3, d1we3i1, d1we3i3, d1we3j1, d1we3j3, d1we3k1, d1we3k3, d1we3l1, d1we3l3, d1we3m1, d1we3m3, d1we3n1, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
   complexed with adp, dms, mg
   complexed with adp, dms, mg

Details for d1we3h2

PDB Entry: 1we3, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (H:) cpn60(GroEL)

SCOPe Domain Sequences for d1we3h2:

Sequence; same for both SEQRES and ATOM records:

>d1we3h2 c.8.5.1 (H:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag

Timeline for d1we3h2:

• d1we3h2 first appeared in SCOP 1.69
  
• d1we3h2 appears in SCOPe 2.06
  
• d1we3h2 appears in the current release, SCOPe 2.08