| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) ![]() duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
| Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein) |
| Protein GroEL, E domain [48594] (4 species) |
| Species Thermus thermophilus [TaxId:274] [110024] (2 PDB entries) Uniprot P61491 |
| Domain d1we3b1: 1we3 B:3-138,B:409-527 [109291] Other proteins in same PDB: d1we3a2, d1we3a3, d1we3b2, d1we3b3, d1we3c2, d1we3c3, d1we3d2, d1we3d3, d1we3e2, d1we3e3, d1we3f2, d1we3f3, d1we3g2, d1we3g3, d1we3h2, d1we3h3, d1we3i2, d1we3i3, d1we3j2, d1we3j3, d1we3k2, d1we3k3, d1we3l2, d1we3l3, d1we3m2, d1we3m3, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ complexed with adp, dms, mg complexed with adp, dms, mg |
PDB Entry: 1we3 (more details), 2.8 Å
SCOPe Domain Sequences for d1we3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we3b1 a.129.1.1 (B:3-138,B:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]}
akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
aveaavekikalaipvXgivpgggvtllraisaveelikklegdeatgakivrraleepa
rqiaenagyegsvivqqilaetknprygfnaatgefvdmveagivdpakvtrsalqnaas
igaliltteavvaekp
Timeline for d1we3b1:
View in 3DDomains from other chains: (mouse over for more information) d1we3a1, d1we3a2, d1we3a3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |