Lineage for d1wdaa3 (1wda A:294-663)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213869Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
    # functionally related to the amidinotransferase, similar active sites
    automatically mapped to Pfam PF03068
  6. 2213870Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)
  7. 2213871Species Human (Homo sapiens) [TaxId:9606] [111154] (17 PDB entries)
    Uniprot Q9UM07
  8. 2213877Domain d1wdaa3: 1wda A:294-663 [109245]
    Other proteins in same PDB: d1wdaa1, d1wdaa2
    complexed with bag, ca, so4

Details for d1wdaa3

PDB Entry: 1wda (more details), 2.3 Å

PDB Description: crystal structure of human peptidylarginine deiminase type4 (pad4) in complex with benzoyl-l-arginine amide
PDB Compounds: (A:) Protein-arginine deiminase type IV

SCOPe Domain Sequences for d1wdaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdaa3 d.126.1.5 (A:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

SCOPe Domain Coordinates for d1wdaa3:

Click to download the PDB-style file with coordinates for d1wdaa3.
(The format of our PDB-style files is described here.)

Timeline for d1wdaa3: