Lineage for d1wdaa3 (1wda A:294-663)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510635Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 510636Superfamily d.126.1: Pentein [55909] (6 families) (S)
  5. 510678Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
    # functionally related to the amidinotransferase, similar active sites
  6. 510679Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)
  7. 510680Species Human (Homo sapiens) [TaxId:9606] [111154] (3 PDB entries)
  8. 510681Domain d1wdaa3: 1wda A:294-663 [109245]
    Other proteins in same PDB: d1wdaa1, d1wdaa2

Details for d1wdaa3

PDB Entry: 1wda (more details), 2.3 Å

PDB Description: crystal structure of human peptidylarginine deiminase type4 (pad4) in complex with benzoyl-l-arginine amide

SCOP Domain Sequences for d1wdaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdaa3 d.126.1.5 (A:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens)}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

SCOP Domain Coordinates for d1wdaa3:

Click to download the PDB-style file with coordinates for d1wdaa3.
(The format of our PDB-style files is described here.)

Timeline for d1wdaa3: