Class b: All beta proteins [48724] (178 folds) |
Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) |
Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins) |
Protein Hyaluronate lyase [49867] (2 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries) Uniprot Q54873 287-1007 |
Domain d1w3ya2: 1w3y A:815-890 [109169] Other proteins in same PDB: d1w3ya1, d1w3ya3 complexed with pvc, so4, xyl |
PDB Entry: 1w3y (more details), 1.65 Å
SCOPe Domain Sequences for d1w3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3ya2 b.24.1.1 (A:815-890) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn petqesapdqevfkkl
Timeline for d1w3ya2: