Lineage for d1w3ya2 (1w3y A:815-890)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459627Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 459628Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 459629Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 459647Protein Hyaluronate lyase [49867] (2 species)
  7. 459652Species Streptococcus pneumoniae [TaxId:1313] [49868] (15 PDB entries)
  8. 459659Domain d1w3ya2: 1w3y A:815-890 [109169]
    Other proteins in same PDB: d1w3ya1, d1w3ya3

Details for d1w3ya2

PDB Entry: 1w3y (more details), 1.65 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin c

SCOP Domain Sequences for d1w3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ya2 b.24.1.1 (A:815-890) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkl

SCOP Domain Coordinates for d1w3ya2:

Click to download the PDB-style file with coordinates for d1w3ya2.
(The format of our PDB-style files is described here.)

Timeline for d1w3ya2: