![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Acetyl-coenzyme A carboxylase, N-terminal domain [418956] (1 species) protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419416] (8 PDB entries) Uniprot Q00955 |
![]() | Domain d1w2xa1: 1w2x A:1482-1814 [109134] Other proteins in same PDB: d1w2xa2, d1w2xb2, d1w2xc2 complexed with rcp |
PDB Entry: 1w2x (more details), 2.8 Å
SCOPe Domain Sequences for d1w2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2xa1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq imynngvshltavddlagvekivewmsyvpakr
Timeline for d1w2xa1:
![]() Domains from other chains: (mouse over for more information) d1w2xb1, d1w2xb2, d1w2xc1, d1w2xc2 |