SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1w2xa2 (1w2x A:1815-2195)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099798Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2099799Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 2099823Domain d1w2xa2: 1w2x A:1815-2195 [109135]
    complexed with rcp

Details for d1w2xa2

PDB Entry: 1w2x (more details), 2.8 Å

PDB Description: crystal structure of the carboxyltransferase domain of acetyl-coenzyme a carboxylase in complex with cp-640186
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1w2xa2:

Sequence, based on SEQRES records: (download)

>d1w2xa2 c.14.1.4 (A:1815-2195) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfa

Sequence, based on observed residues (ATOM records): (download)

>d1w2xa2 c.14.1.4 (A:1815-2195) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiyg
qislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeas
rlekiarirswypasvdheddrqvatwieenyktlddklkglklesfa

SCOPe Domain Coordinates for d1w2xa2:

Click to download the PDB-style file with coordinates for d1w2xa2.
(The format of our PDB-style files is described here.)

Timeline for d1w2xa2: