Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies) beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e |
Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (1 family) |
Family d.241.2.1: Trigger factor ribosome-binding domain [102736] (1 protein) |
Protein Trigger factor ribosome-binding domain [102737] (2 species) |
Species Escherichia coli [TaxId:562] [102738] (3 PDB entries) |
Domain d1w26a2: 1w26 A:1-131 [109086] Other proteins in same PDB: d1w26a1, d1w26a3, d1w26b1, d1w26b3 |
PDB Entry: 1w26 (more details), 2.7 Å
SCOP Domain Sequences for d1w26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w26a2 d.241.2.1 (A:1-131) Trigger factor ribosome-binding domain {Escherichia coli} mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl eaievekpive
Timeline for d1w26a2: