Lineage for d1w26a2 (1w26 A:1-131)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516622Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
    beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e
  4. 516630Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (1 family) (S)
  5. 516631Family d.241.2.1: Trigger factor ribosome-binding domain [102736] (1 protein)
  6. 516632Protein Trigger factor ribosome-binding domain [102737] (2 species)
  7. 516633Species Escherichia coli [TaxId:562] [102738] (3 PDB entries)
  8. 516639Domain d1w26a2: 1w26 A:1-131 [109086]
    Other proteins in same PDB: d1w26a1, d1w26a3, d1w26b1, d1w26b3

Details for d1w26a2

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

SCOP Domain Sequences for d1w26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26a2 d.241.2.1 (A:1-131) Trigger factor ribosome-binding domain {Escherichia coli}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

SCOP Domain Coordinates for d1w26a2:

Click to download the PDB-style file with coordinates for d1w26a2.
(The format of our PDB-style files is described here.)

Timeline for d1w26a2: