Lineage for d1w26b1 (1w26 B:248-432)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450734Fold a.223: TF C-terminus (Pfam 05698) [109997] (1 superfamily)
    multihelical; open array
  4. 450735Superfamily a.223.1: TF C-terminus (Pfam 05698) [109998] (1 family) (S)
  5. 450736Family a.223.1.1: TF C-terminus (Pfam 05698) [109999] (1 protein)
    includes the upstream linker region not covered by the Pfam model
  6. 450737Protein Trigger factor, C-terminal domain [110000] (2 species)
  7. 450738Species Escherichia coli [TaxId:562] [110001] (1 PDB entry)
  8. 450740Domain d1w26b1: 1w26 B:248-432 [109088]
    Other proteins in same PDB: d1w26a2, d1w26a3, d1w26b2, d1w26b3

Details for d1w26b1

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

SCOP Domain Sequences for d1w26b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26b1 a.223.1.1 (B:248-432) Trigger factor, C-terminal domain {Escherichia coli}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

SCOP Domain Coordinates for d1w26b1:

Click to download the PDB-style file with coordinates for d1w26b1.
(The format of our PDB-style files is described here.)

Timeline for d1w26b1: