Lineage for d1w26b3 (1w26 B:132-247)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 501850Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 501851Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 501987Protein Trigger factor PPIase domain [75388] (3 species)
  7. 501988Species Escherichia coli [TaxId:562] [89881] (2 PDB entries)
  8. 501990Domain d1w26b3: 1w26 B:132-247 [109090]
    Other proteins in same PDB: d1w26a1, d1w26a2, d1w26b1, d1w26b2

Details for d1w26b3

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

SCOP Domain Sequences for d1w26b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26b3 d.26.1.1 (B:132-247) Trigger factor PPIase domain {Escherichia coli}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOP Domain Coordinates for d1w26b3:

Click to download the PDB-style file with coordinates for d1w26b3.
(The format of our PDB-style files is described here.)

Timeline for d1w26b3: