![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
![]() | Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species) |
![]() | Species Prosthecochloris vibrioformis [TaxId:1098] [110362] (2 PDB entries) Uniprot Q59334 |
![]() | Domain d1w1zb_: 1w1z B: [109082] complexed with mg, shf |
PDB Entry: 1w1z (more details), 2.6 Å
SCOPe Domain Sequences for d1w1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1zb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr agadiiftyyakeaakklr
Timeline for d1w1zb_: