PDB entry 1w1z

View 1w1z on RCSB PDB site
Description: Structure of the plant like 5-Aminolaevulinic Acid Dehydratase from Chlorobium vibrioforme
Class: synthase
Keywords: synthase, tetrapyrrole biosynthesis, alad, porphyrin biosynthesis, heme biosynthesis, lyase, magnesium
Deposited on 2004-06-24, released 2004-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2959
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: PROSTHECOCHLORIS VIBRIOFORMIS [TaxId:1098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1za_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: PROSTHECOCHLORIS VIBRIOFORMIS [TaxId:1098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1zb_
  • Heterogens: SHF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1zA (A:)
    msqldllnivhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfr
    ftidraveeckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelci
    mtdvaldpftpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigai
    realdetdhsdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeve
    ldivegadivmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvm
    mesllcmkragadiiftyyakeaakklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1zA (A:)
    vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
    ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
    tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
    sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
    vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
    agadiiftyyakeaakklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w1zB (B:)
    msqldllnivhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfr
    ftidraveeckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelci
    mtdvaldpftpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigai
    realdetdhsdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeve
    ldivegadivmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvm
    mesllcmkragadiiftyyakeaakklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1zB (B:)
    vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
    ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
    tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
    sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
    vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
    agadiiftyyakeaakklr