SCOPe 2.01: Domain d1w1ia2: 1w1i A:509-766

Lineage for d1w1ia2 (1w1i A:509-766)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1w1ia2: 1w1i A:509-766 [109044]
   Other proteins in same PDB: d1w1ia1, d1w1ib1, d1w1ic1, d1w1id1, d1w1ie_, d1w1if_, d1w1ig_, d1w1ih_
   complexed with nag, ndg, zn

Details for d1w1ia2

PDB Entry: 1w1i, 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1w1ia2:

Sequence; same for both SEQRES and ATOM records:

>d1w1ia2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d1w1ia2:

• d1w1ia2 first appeared in SCOP 1.69
  
• d1w1ia2 appears in SCOP 1.75
  
• d1w1ia2 appears in SCOPe 2.02
  
• d1w1ia2 appears in the current release, SCOPe 2.08