Lineage for d1w1ia2 (1w1i A:509-766)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. Domain d1w1ia2: 1w1i A:509-766 [109044]
    Other proteins in same PDB: d1w1ia1, d1w1ib1, d1w1ic1, d1w1id1, d1w1ie_, d1w1if_, d1w1ig_, d1w1ih_
    complexed with nag, zn

Details for d1w1ia2

PDB Entry: 1w1i (more details), 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1w1ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ia2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d1w1ia2 are not available.

Timeline for d1w1ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1ia1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w1ib1, d1w1ib2, d1w1ic1, d1w1ic2, d1w1id1, d1w1id2, d1w1ie_, d1w1if_, d1w1ig_, d1w1ih_