Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
Protein Signal recognition particle receptor, FtsY [47368] (3 species) |
Species Thermotoga maritima [TaxId:2336] [109766] (1 PDB entry) Uniprot Q9WZ40 |
Domain d1vmab1: 1vma B:1-81 [108889] Other proteins in same PDB: d1vmaa2, d1vmab2 Structural genomics target complexed with cit, mg |
PDB Entry: 1vma (more details), 1.6 Å
SCOPe Domain Sequences for d1vmab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmab1 a.24.13.1 (B:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} mglfdflkkglqktketffgrvvkllkgkklddetreeleelliqadvgvetteyilerl eekdgdaleslkeiileilnf
Timeline for d1vmab1: