SCOP 1.69: Domain d1vmab1: 1vma B:1-81

Lineage for d1vmab1 (1vma B:1-81)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [109766] (1 PDB entry)

8. Domain d1vmab1: 1vma B:1-81 [108889]
   Other proteins in same PDB: d1vmaa2, d1vmab2
   Structural genomics target

Details for d1vmab1

PDB Entry: 1vma, 1.6 Å

PDB Description: Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution

SCOP Domain Sequences for d1vmab1:

Sequence; same for both SEQRES and ATOM records:

>d1vmab1 a.24.13.1 (B:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima}
mglfdflkkglqktketffgrvvkllkgkklddetreeleelliqadvgvetteyilerl
eekdgdaleslkeiileilnf

Timeline for d1vmab1:

• d1vmab1 is new in SCOP 1.69
  
• d1vmab1 appears in SCOP 1.71
  
• d1vmab1 appears in the current release, SCOPe 2.08