Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
Superfamily d.250.1: Folate-binding domain [103025] (2 families) some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins) |
Protein Hypothetical protein YgfZ, N-terminal domain [103029] (1 species) |
Species Escherichia coli [TaxId:562] [103030] (2 PDB entries) Uniprot P39179 |
Domain d1vlya2: 1vly A:3-243 [108872] Other proteins in same PDB: d1vlya1 Structural genomics target complexed with act, ca, cl, edo |
PDB Entry: 1vly (more details), 1.3 Å
SCOPe Domain Sequences for d1vlya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlya2 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]} ftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhllaah cdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgvag fqaraalanlfselpskekqvvkegattllwfehpaerflivtdeatanmltdklrgeae lnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgcytgqemvarakfrg a
Timeline for d1vlya2: