Lineage for d1vlya2 (1vly A:3-243)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614636Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 2614637Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 2614638Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 2614653Protein Hypothetical protein YgfZ, N-terminal domain [103029] (1 species)
  7. 2614654Species Escherichia coli [TaxId:562] [103030] (2 PDB entries)
    Uniprot P39179
  8. 2614655Domain d1vlya2: 1vly A:3-243 [108872]
    Other proteins in same PDB: d1vlya1
    Structural genomics target
    complexed with act, ca, cl, edo

Details for d1vlya2

PDB Entry: 1vly (more details), 1.3 Å

PDB Description: Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 A resolution
PDB Compounds: (A:) Unknown protein from 2D-page

SCOPe Domain Sequences for d1vlya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlya2 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]}
ftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhllaah
cdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgvag
fqaraalanlfselpskekqvvkegattllwfehpaerflivtdeatanmltdklrgeae
lnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgcytgqemvarakfrg
a

SCOPe Domain Coordinates for d1vlya2:

Click to download the PDB-style file with coordinates for d1vlya2.
(The format of our PDB-style files is described here.)

Timeline for d1vlya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlya1