Lineage for d1vler2 (1vle R:1-195)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861004Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 861105Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 861214Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 861215Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 861236Domain d1vler2: 1vle R:1-195 [108779]
    Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen1, d1vleo1, d1vleo2, d1vlep1, d1vleq1, d1vleq2, d1vler1, d1vles1, d1vles2, d1vlet1, d1vleu1, d1vleu2, d1vlev1, d1vlew1, d1vlew2, d1vlex1

Details for d1vler2

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (R:) Pyrogallol hydroxytransferase small subunit

SCOP Domain Sequences for d1vler2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vler2 d.58.1.5 (R:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1vler2:

Click to download the PDB-style file with coordinates for d1vler2.
(The format of our PDB-style files is described here.)

Timeline for d1vler2: