Lineage for d1vlen1 (1vle N:196-274)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790758Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) (S)
  5. 790759Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins)
    Pfam PF05738
  6. 790770Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 790771Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
    Uniprot P80564
  8. 790790Domain d1vlen1: 1vle N:196-274 [108770]
    Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen2, d1vleo1, d1vleo2, d1vlep2, d1vleq1, d1vleq2, d1vler2, d1vles1, d1vles2, d1vlet2, d1vleu1, d1vleu2, d1vlev2, d1vlew1, d1vlew2, d1vlex2

Details for d1vlen1

PDB Entry: 1vle (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (N:) Pyrogallol hydroxytransferase small subunit

SCOP Domain Sequences for d1vlen1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlen1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOP Domain Coordinates for d1vlen1:

Click to download the PDB-style file with coordinates for d1vlen1.
(The format of our PDB-style files is described here.)

Timeline for d1vlen1: