SCOP 1.75: Domain d1vlep2: 1vle P:1-195

Lineage for d1vlep2 (1vle P:1-195)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
   Uniprot P80564

8. Domain d1vlep2: 1vle P:1-195 [108775]
   Other proteins in same PDB: d1vlem1, d1vlem2, d1vlen1, d1vleo1, d1vleo2, d1vlep1, d1vleq1, d1vleq2, d1vler1, d1vles1, d1vles2, d1vlet1, d1vleu1, d1vleu2, d1vlev1, d1vlew1, d1vlew2, d1vlex1

Details for d1vlep2

PDB Entry: 1vle, 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

PDB Compounds: (P:) Pyrogallol hydroxytransferase small subunit

SCOP Domain Sequences for d1vlep2:

Sequence; same for both SEQRES and ATOM records:

>d1vlep2 d.58.1.5 (P:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

Timeline for d1vlep2:

• d1vlep2 first appeared in SCOP 1.69
  
• d1vlep2 appears in SCOP 1.73
  
• d1vlep2 appears in SCOPe 2.01
  
• d1vlep2 appears in the current release, SCOPe 2.08