Lineage for d1vldv1 (1vld V:196-274)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113917Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) (S)
  5. 1113918Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins)
    Pfam PF05738
  6. 1113929Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 1113930Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
    Uniprot P80564
  8. 1113965Domain d1vldv1: 1vld V:196-274 [108762]
    Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2
    complexed with 4mo, act, ca, mgd, sf4

Details for d1vldv1

PDB Entry: 1vld (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (V:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vldv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vldv1 b.3.5.1 (V:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOPe Domain Coordinates for d1vldv1:

Click to download the PDB-style file with coordinates for d1vldv1.
(The format of our PDB-style files is described here.)

Timeline for d1vldv1: