Class b: All beta proteins [48724] (144 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family) |
Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins) |
Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) |
Domain d1vldv1: 1vld V:196-274 [108762] Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2 |
PDB Entry: 1vld (more details), 2.35 Å
SCOP Domain Sequences for d1vldv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vldv1 b.3.5.1 (V:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1vldv1: