Lineage for d1vkzb2 (1vkz B:4-93)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360442Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1360577Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species)
  7. 1360580Species Thermotoga maritima [TaxId:2336] [110500] (1 PDB entry)
    Uniprot Q9X0X7
  8. 1360582Domain d1vkzb2: 1vkz B:4-93 [108702]
    Other proteins in same PDB: d1vkza1, d1vkza3, d1vkzb1, d1vkzb3
    Structural genomics target
    complexed with edo

Details for d1vkzb2

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkzb2:

Sequence, based on SEQRES records: (download)

>d1vkzb2 c.30.1.1 (B:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflvegvsnwrsnvfgpvkevarleg

Sequence, based on observed residues (ATOM records): (download)

>d1vkzb2 c.30.1.1 (B:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflversnvfgpvkevarleg

SCOPe Domain Coordinates for d1vkzb2:

Click to download the PDB-style file with coordinates for d1vkzb2.
(The format of our PDB-style files is described here.)

Timeline for d1vkzb2: