SCOPe 2.03: Domain d1vkzb1: 1vkz B:314-399

Lineage for d1vkzb1 (1vkz B:314-399)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Glycinamide ribonucleotide synthetase (GAR-syn), C-domain [51250] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [110323] (1 PDB entry)
   Uniprot Q9X0X7

8. Domain d1vkzb1: 1vkz B:314-399 [108701]
   Other proteins in same PDB: d1vkza2, d1vkza3, d1vkzb2, d1vkzb3
   Structural genomics target
   complexed with edo

Details for d1vkzb1

PDB Entry: 1vkz, 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution

PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkzb1:

Sequence; same for both SEQRES and ATOM records:

>d1vkzb1 b.84.2.1 (B:314-399) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Thermotoga maritima [TaxId: 2336]}
gfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmgtgetk
eearrkayelaekvhfegktyrrdia

Timeline for d1vkzb1:

• d1vkzb1 first appeared in SCOP 1.69
  
• d1vkzb1 appears in SCOPe 2.02
  
• d1vkzb1 appears in SCOPe 2.04
  
• d1vkzb1 appears in the current release, SCOPe 2.08