Lineage for d1vkzb1 (1vkz B:314-399)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471225Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 471273Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 471274Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 471285Protein Glycinamide ribonucleotide synthetase (GAR-syn), C-domain [51250] (2 species)
  7. 471288Species Thermotoga maritima [TaxId:243274] [110323] (1 PDB entry)
  8. 471290Domain d1vkzb1: 1vkz B:314-399 [108701]
    Other proteins in same PDB: d1vkza2, d1vkza3, d1vkzb2, d1vkzb3
    Structural genomics target

Details for d1vkzb1

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution

SCOP Domain Sequences for d1vkzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkzb1 b.84.2.1 (B:314-399) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Thermotoga maritima}
gfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmgtgetk
eearrkayelaekvhfegktyrrdia

SCOP Domain Coordinates for d1vkzb1:

Click to download the PDB-style file with coordinates for d1vkzb1.
(The format of our PDB-style files is described here.)

Timeline for d1vkzb1: