Lineage for d1vkzb2 (1vkz B:4-93)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482937Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 482938Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 482939Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 483032Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species)
  7. 483035Species Thermotoga maritima [TaxId:243274] [110500] (1 PDB entry)
  8. 483037Domain d1vkzb2: 1vkz B:4-93 [108702]
    Other proteins in same PDB: d1vkza1, d1vkza3, d1vkzb1, d1vkzb3
    Structural genomics target

Details for d1vkzb2

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (B:)

SCOP Domain Sequences for d1vkzb2:

Sequence, based on SEQRES records: (download)

>d1vkzb2 c.30.1.1 (B:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflvegvsnwrsnvfgpvkevarleg

Sequence, based on observed residues (ATOM records): (download)

>d1vkzb2 c.30.1.1 (B:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima}
vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
pgseeflversnvfgpvkevarleg

SCOP Domain Coordinates for d1vkzb2:

Click to download the PDB-style file with coordinates for d1vkzb2.
(The format of our PDB-style files is described here.)

Timeline for d1vkzb2: