Lineage for d1vkec_ (1vke C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735134Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 2735146Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 2735147Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)
    Uniprot Q9X1V5
  8. 2735150Domain d1vkec_: 1vke C: [108652]
    Structural genomics target
    complexed with mpd, unl

Details for d1vkec_

PDB Entry: 1vke (more details), 1.56 Å

PDB Description: Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (TM1620) from Thermotoga maritima at 1.56 A resolution
PDB Compounds: (C:) carboxymuconolactone decarboxylase family protein

SCOPe Domain Sequences for d1vkec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkec_ a.152.1.2 (C:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
gtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasdeei
fealdialvvggsiviphlrravgfleelremekngetis

SCOPe Domain Coordinates for d1vkec_:

Click to download the PDB-style file with coordinates for d1vkec_.
(The format of our PDB-style files is described here.)

Timeline for d1vkec_: