SCOPe 2.08: Domain d1vkea_: 1vke A:

Lineage for d1vkea_ (1vke A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.2: CMD-like [101468] (2 proteins)
   Pfam PF02627; hexamer of single-domain subunits

6. Protein Hypothetical protein TM1620 [101469] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)
   Uniprot Q9X1V5

8. Domain d1vkea_: 1vke A: [108650]
   Structural genomics target
   complexed with mpd, unl

Details for d1vkea_

PDB Entry: 1vke, 1.56 Å

PDB Description: Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (TM1620) from Thermotoga maritima at 1.56 A resolution

PDB Compounds: (A:) carboxymuconolactone decarboxylase family protein

SCOPe Domain Sequences for d1vkea_:

Sequence, based on SEQRES records:

>d1vkea_ a.152.1.2 (A:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
kkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddci
ryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl

Sequence, based on observed residues (ATOM records):

>d1vkea_ a.152.1.2 (A:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
kkfvearrelnekvsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddcir
yhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl

Timeline for d1vkea_:

• d1vkea_ first appeared in SCOP 1.69
  
• d1vkea_ appears in SCOPe 2.07