SCOP 1.69: Domain d1vkdd_: 1vkd D:

Lineage for d1vkdd_ (1vkd D:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (4 families)

5. Family b.67.2.4: TM1225-like predicted glycosylases [DUF377] (Pfam 04041) [110284] (1 protein)

6. Protein Hypothetical protein TM1225 [110285] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [110286] (1 PDB entry)

8. Domain d1vkdd_: 1vkd D: [108647]

Details for d1vkdd_

PDB Entry: 1vkd, 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution

SCOP Domain Sequences for d1vkdd_:

Sequence; same for both SEQRES and ATOM records:

>d1vkdd_ b.67.2.4 (D:) Hypothetical protein TM1225 {Thermotoga maritima}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrnsm

Timeline for d1vkdd_:

• d1vkdd_ is new in SCOP 1.69
  
• d1vkdd_ appears in SCOP 1.71
  
• d1vkdd_ appears in the current release, SCOPe 2.08